SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014497001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014497001
Domain Number 1 Region: 358-678
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014497001
Domain Number - Region: 203-251
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0235
Family Anti-platelet protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014497001
Sequence length 692
Sequence
MLRQTDTIISAGMKIGYNRKTGEVWSFTSWKNAEDPGLGPVSLKMDPETHQFVIMWNSQM
VWSSGVWNGHAFSSVPEMRLDYIFNYSYFEDMSEAYFTYSLYDNSIISRLLIDVSGNIKQ
LTWLDRSGWNLFWSQPQNFECDYYSYCGSFSSCNNQTTPICQCLYGFRPNSAGDWMMNQF
RDGCVRKTSLQCDDLTSVNSEKDKFLKMANVKFPQSPQILETQSIETCKMTCLNKCSCNA
YAHNGSCLMWDQILLNLQQLSKKDPDGRTLYLKLAASELQNSRESKMPRWVIGMVVVAVL
VLLLASYICYRQMKRVQDREEMTTSQDILLYEFGMGSKATENELNEGNRVGKDKNKDAWL
PLFSFASVSAATEHFSTENKLGQGGFGPVYKGELFNGQEIAVKRLSRSSGQGLEELKNET
VLLAELQHRNLVRLLGCCIEQGEKILIYEYMPNKSLDSFLFDPNKRGQLDWAKRVSIIEG
IAQGLLYLHEYSRLRIIHRDLKASNILLDNDMNPKISDFGMARMFGGNESYANTNRIVGT
YGYMSPEYALEGLFSTKSDVFSFGVLMLEILSGKKNTGFYNSDTLNLIGYAWELWKSDMA
INLMDPMLEGQSSQYMLLRYINVGLLCVEEIAADRPTLSEVVSMLTNELAVLPSPKHPAF
STVRSMENPRSSMSRPEIYSANGLSISVMEAR
Download sequence
Identical sequences E0CSX4
GSVIVT01014497001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]