SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014498001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014498001
Domain Number 1 Region: 234-334
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000467
Family Protein kinases, catalytic subunit 0.0046
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014498001
Domain Number - Region: 119-181
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0018
Family Anti-platelet protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014498001
Sequence length 340
Sequence
MTNQAFKTSFVYNEDEAYYLYELKDNLSITRLTLNELGSINRFVLSESSTEWAIMYTVQN
DLCDNYGHCGANGFCRIGNTPICECLDGFVPKSQNEWEFLNWTSGCIRSTPLDCQKGEGF
IEVKGVKLPDLLDFWVNKRTTLRECRAECLKNCSCTAYANSNISKGGSGCLMWFGNLIDV
REFHAQESEQTVYVRMPASELESRRNSSQKRKHLVIVVLVSMASVVLILGLYAVDGQFSV
KSDVFSLGVLLLEIVSGKKNRGFCHPDHYHNLLGHVWLLWNENRALELMEPCLVDSYVES
QVLRCIQVGLLCIQKLPEDRPSMSSVVLMLVNEEITLPQP
Download sequence
Identical sequences GSVIVT01014498001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]