SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014499001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014499001
Domain Number 1 Region: 533-820
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-78
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 138-240
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-22
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000256
Family Protein kinases, catalytic subunit 0.0056
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014499001
Domain Number - Region: 401-471
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00122
Family Pan module (APPLE domain) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014499001
Sequence length 862
Sequence
MSPEYGIDGKFSAKSDVFGFGVLLLEIVSGKKNRGFSHPHHHHNLLGHAWMLWNEDKALE
LMDACLRDSCVESQVPRCIQVDLFCVQKLPANRPTISSVIFTLGHEEAVLPQPKQPGFFR
ERSSVDDEDAIQKMKLLENPIEGSYGVLSIGNDGNLALLNKTKGIIWSSSSSRGAENPTA
QLLETGNLVLRDESDVDPEIYTWQSFDFPCDTLLAGMKFGWNLKDGQNRYLTSWRNASDP
APGDFTWRIDIVGLPQMVLRKGSEKMFRSGPWNGLSFNGLPLIKKTFFTSSLVDNADEFY
YSYELDDKSIITRLTLDELGIYQRLVLSKTSKKWDIVYPLQDDLCDDYGRCGANSICRIN
DRPICECLEGFVPKSQEEWEFQNWTSGCIRRTQLDCQKGEGFMELEGVKLPDLLEFWVSK
SMTLKECEEECLRNCSCTAYTNSNISEGGSGCLIWFRDLIDIREFHEDNKQNIYIRMPAS
ELELMNGSSQSKKRLVVVVVSSTASGVFILGLVLWFIVRKRKKRGSETEKEDLELQLFDL
ATISSATNNFSDSNLIGKGGFGPVYKGTLASGQEIAVKRLSNNSGQGFQEFKNEVILIAK
LQHRNLVRLLGYCVEEERMLVYEYMPNKSLDCFIFDQERSMLLNWPRRFDIVMGVARGLL
YLHQDSRLRIIHRDLKTSNILLDSELNPKISDFGIARVFGGQQTEAKTKLVIGTYGYMSP
EYAIDGKFSVKSDVFSFGVLLLEIVSSKKNRGFCHPDHHHNLLGHAWLLWNERKTMELMD
AGLKDSCIESQVLRCIQVGLLCVQKLPVDRPTMSSIIFMLGNEEATLPQPKQPGFFFERS
SEGDDKGCYTENTVTLTILEAR
Download sequence
Identical sequences GSVIVT01014499001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]