SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014500001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014500001
Domain Number 1 Region: 1566-1854
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-81
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 355-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-79
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 869-1093
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-69
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 4 Region: 1134-1243
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-28
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Domain Number 5 Region: 72-153,185-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-28
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014500001
Domain Number - Region: 693-736
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000504
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 
Domain Number - Region: 1404-1469
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00182
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014500001
Sequence length 1901
Sequence
MDALARLVIIFSSVLFIVPISIAVDTITVNQPIRYGETIISAGGSFELGFYTPENSKNQY
LGIWYKKVTPRTVVWVANGDFPLTDSLGVLKVTDQGTLVILNGTNSIIWSSNASRSAQNP
TAQLLESGNLVLKNGNDDDPENFLWQSFDHPCSTLLPNMKLGRNKSTGQEWYLSSSKSTD
DPSKGNLTYRLDPHGYPQLLKRNGLILTFCSGPWNGLRFSGFRALAGKSIYKHVFTFNEK
EMYYTYELLDSSVVSRLVLNSNGDVQRLTWTDVTGWTEYSTMPMDDCDGYAFCGVHGFCN
INQVPKCGCLDGFQPNFPNNWEMGVWSNGCFRSRPLDCQRGEWFKKYSGKIPPFDLELPL
FDLATILNATNNFSIENKLGEGGFGPVYKGLLQQGQEVAVKRLSKDSRQGLIEFKTEVIH
IANLQHRNLVKLLGCCIHGQEKMLIYEYMSNKSLESFIFDKRRSKELDWPKRFLIINGIA
RGLLYLHQDSRLRIIHRDLKADNILLDSEMGPKISDFGIARSFGGNETEANTTKVVGTLG
YISPEYASEGLYSVKSDVFSFGVMVLEIVSGKRNRGFSHPDHRLNLLGHAWTLYTEGRYL
ELMDAMVGDTFQPSEVLRSIHVGLLCVQHCADDRPSMSSVVLMLSSEVALPQPREPGFFC
DWNSSRNCRSYSGTEAITLLVAWFKVTDLDRYLSSWKTTDDPSMGNFTYELDPSGFLQLI
RRNGSAVTFRSGSWNGLRFSGFPALRPNPIYKYAFIFNDKEIFYTYELINSSVVSRLVLN
SNGYAQRLTWIDQTHGWIIFSSVPVRIIYLHSSSKMKKTRWVIVGTLAVIMGMILLGLLL
TLCVLKKKGKQLNSDMTIQQLEGQNEDLRLPLFDYATILNATNNFGIANKVGEGGFGPVY
KGMLETGQEIAVKRLSKDSRQGLHEFKNEVEYIAKLQHRNLVKLLGYCIHNEEKMLIYEY
MPNKSLDSFIFDERRGMELDWPKRCLIINGIARGLLYLHQDSRLRIIHRDLNAGNILLDS
EMSPKISEFGMAESFGANQIEANTERLVGTFGYMPPENASEGLYSLKSDVFSFGVLVLEI
VTGKRNRGFSHPDRRLWSNCFFLHIDMLRLDGHPGSSENRYLGIWYKKISTGTVVWVADR
DVPLNDSSGILKLDERGTLVLLNKANMTIWSSNSSRSVQSPVAQLLDTGNLVVRNENDSD
PENFLWQSFDYPGDTFLPGMKYGKNLITGLDSYLTSWKSTDDPSTGDFTNRLDPRGFPQM
FLKEGSVVTFRSGPWNGLRFSGMPNLKPNSIYTFHFVLNQKEIYYTYELINSSVVTRMVL
SPNGVLQDYTWIDRRQGWLLYLTAQMDNCDRYALCGAYGSCDINNSPACGCLKGFVPKHP
NDWNVADWSGGCVRRTRLNCQNGDGFLKYPGVKLPDTQDSWFNMTMNLKECKMKCLKNCN
CTAYANSDIRNGGSGCVLWFGNLIDIREYNENGQDLYVRMAASELEEYESSDQKKLVKII
VIPIGLAGLILLVIFVILHVLKRKRLKKKAPLGEGNSSQINTFCSLITMGHNPERDHTNE
SEKEDLELPLFDFDTIAEATDNFSRSNKLGQGGFGPVYKGMLRGGQEIAVKRLSKNSRQG
LDEFKNEVLCIAKLQHRNLVKLLGYCIQYEEKMLIYEYMPNKSLNSFIFDQTQSMLLDWP
KRFHIIKGIARGLLYLHQDSRLRIIHRDLKASNILLDQEMNPKISDFGMARSFEENETEA
NTTRVVGTYGYMSPEYAVDGLFSVKSDVYSFGVLVLEIVSGKRNRGFCDPDHHLNLLGHA
WRLYRKGRSIELTDASIQQSCNPLEVLQSIHVGLLCVQQSPDDRPSMSSVVMMLGSEIAL
PQPREPGFFVARRMIEAADSSSGIYEPCSVNDITVTFLAAR
Download sequence
Identical sequences GSVIVT01014500001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]