SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014501001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014501001
Domain Number 1 Region: 1541-1836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-79
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 2315-2608
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-78
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 1129-1211,1243-1274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-27
Family alpha-D-mannose-specific plant lectins 0.008
Further Details:      
 
Domain Number 4 Region: 1889-1998
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-27
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014501001
Domain Number - Region: 1402-1443
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0247
Family Hairpin loop containing domain 0.098
Further Details:      
 
Domain Number - Region: 2160-2201
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Hairpin loop containing domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014501001
Sequence length 2646
Sequence
MTCFQKTSLSFANCQFHLLKRVVFIRARFLTPKPPFLFSKQTMFHLTRCGFYTKARPPPH
DRYTLCNLRNSLCPNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXTNGVVIQISDVIPDDSNRRYLGIWYKKVSTMTVVWVANREIPL
NDSSGVLKVTDQGTLAILNGSNTNILWSSNSSRSARNPTAQLLDSGNLVMKDGNDDNPEN
FLWQSFDYPCNTLLPGMKLGRNTVTGLDRYLSAWKSVDDPSKGNFTYRLDPSGYPQLILR
KGSAVTFRSGPWNGLRFSGFPELGSNPVYTYEFVFNEKEMYFRYELVNSSVVSRLVLNPD
GSKQRVNWIDRTHGWILYSSAPMDSCDSYALCGVYGSCNINRSPKCECMEGFVPKFPNDW
DMADWSNGCVRSTPLGCQNGEGFVKFSGVKLPDTRNSWFNRSMDLKECAAVCLSNCSCTA
YTNLDIRDGGSGCLLWFGDLIDIREFNENGQELYVRMAASELGRSGNFKGKKREWVIVGS
VSSLGIILLCLLLTLYLLKKKKLRKKGTMGYNLEGGQKEDVELPLFDFATVSKATNHFSI
HNKLGEGGFGLVYKGTLQEEQEIAVKRLSKNSGQGLNEFKNEVIYISKLQHRNLVRLLGG
CIHDEEKMLIYEYMPNKSLDSFIFDKTRSMELDWNKRFLIINGIARGLLYLHQDSRLRII
HRDLKADNVLLDEEMTPKISDFGIARSFGGNETEANTKRVVGTYGYMSPEYAIDGLYSTK
SDVFSFGVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTLYMEGRSMELIDSSVGDIHNLSQ
VLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQPKEPGFFTGRGSTSSSGNQGPFS
GNGITITIPDNSSRRYLGMWYKKVSIRTVVWVANRETPLADSSGVLKVTDQGTLAVLNGT
NTILWSSNSSRSARNPTAQILESGNLVMKDGNDDNPENFLWQSFDYPCNTLLPGMKLGRN
TVTGLDRYLSAWKSADDPSKGDFTYRLDPRGYPQLILRKGSAVTFRSGPWNGVRFSGFPE
LGPNSIYTYEFVFNEKEMYFRYELVNSSVVSRLVLNPDGSKQRVNWIDRTNGWILYSSAP
KDDCDSYALCGVYGICNINRSPKCECMEGFVPKFQNDWDMADWSNGCVRSTPLDCQNGEG
FVKFSGVKLPDTRNSWFNRSMGLMECAAVCLSNCSCTAYTNLDIRDGGSGCLLWFGDLID
IREFNENGQEIYVRMAASELGGSKESGSNLKGKKRKWIIVGSVSSVVIILVSLFLTLYLL
KTKRQRKKGNNPYYMHHYVFRTMGYNLEVGHKEDSKLQLFDFATVSKATNHFSFDNKLGE
GGFGLVYKGILQEGQEIAVKRLSKDSGQGLDELKNEVIYIAKLQHRNLVRLLGCCIHGEE
KMLIYEYMSNKSLDSFIFDKTQSMELDWNKRFLIINGIARGLLYLHQDSRLRIIHRDLKA
GNILLDEEMAPKISDFGMARSFGGNETEANTKRVVGTYGYMSPEYAIDGLYSTKSDVFSF
GVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTLYMEGRSMELIDSSVGDMHDLSQVLCSIN
VGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQPKEPGFFTGRKAQSSSGNQGPFSGNGVTI
TMLDGR
Download sequence
Identical sequences GSVIVT01014501001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]