SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014512001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014512001
Domain Number 1 Region: 466-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-80
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 55-164
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-30
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014512001
Domain Number - Region: 325-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000667
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014512001
Sequence length 910
Sequence
MCSGLPHWIFKSVTGLYSTLLDRQNSWFNQSNRTMNCKGNQYLGIWYKKVTPRTVVWVAN
RELPVTDSSGVLKVTDQGSLVILNGSNGLIWSSNSSRSARNPTAQLLDSGNLVIKSGNDS
DPDNFLWQSFDYPGDTLLPGMKHGRNTVTGLDRYLSSWKSNDDPSKGDFTYGLDPSGCPQ
LFLRSGSTVIFRSGPWNGIRFNGFPELRPNPVFNYSFVFNEKEMYFTYKLVNSSVLSRLV
LNPNGNVQRLIWIGRTKSWNVYSTAYKDDCDSYALCGAYSTCNIHRSPRCGCMKGFVPKF
PYQWDTMDWSNGCVRKTSLDCQKGDGFVKCSGVKLPDTRNSWFNESMNLKECASLCLRNC
SCSAYTNSDIKGGGSGCLLWFGDLIDVKEFTENGQDFYIRMAASELDAISKVTKRRWVIV
STVSIAGMILLSLVVTLYLLKKRLKRKGTTELNNEGAETNERQEDLELPLFDLDTILNAT
HNFSRNNKLGEGGFGPVYKGMLQDGKEIAVKRLSKESNQGLDEFKNEVIYISKLQHRNLV
KLLGCCIHGEEKMLIYEYMPNKSLNFFIFDGIQSMVLDWPKRFVIINGIARGLLYLHQDS
RLRIIHRDLKADNVLLDNEMNPRISDFGMARSFGGNETQARTKRVVGTYGYMSPEYAIDG
VYSVKSDVFSFGVLLLEIISGKRNRGFNHPDHDLNLLGHAWTLYMERTPLELIDASVGDT
YNQSEVLRALNVGLLCVQRHPDDRPNMSSVVLMLSSEGALRQPKEPGFFTERNMLEADSL
QCKHADVFIRIRCFSSTNSSSKKKPKQIIFISISITRIIHVSLFMTLYMLKKREKQLKRK
GNYFNYFWSLLSTILLLFQQQTHLRCHQVINLFWCFLYIMKIIHRYKFNNRSRPYNESYS
FKKILITCML
Download sequence
Identical sequences GSVIVT01014512001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]