SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014518001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014518001
Domain Number 1 Region: 237-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000842
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014518001
Domain Number - Region: 89-153
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000224
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014518001
Sequence length 278
Sequence
MRLVLTPDGYSRRFTWTDQKNEWTLYSTTQKDDCDNYAICGVYGICKIDESPKCECMKGF
RPKFQSNWDMADWSKGCVRSTPLDCQKGDGFVKYSGVKLPDTRNSWFDESMNLKECASLC
LRNCSCTAYANSDIRGGGSGCLLWFDDLIDIRDFTQNGQEFYARMAASESDALSSLNSSS
KKKKKQAIAISISITGVVLLSLVLTLCVLKKRKRRLKRRGYMEHNIEGDETNEGQEHLEI
PLFDLDTLLNATNNFSSDNKLGEGGFGPVYKIKCEAWY
Download sequence
Identical sequences GSVIVT01014518001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]