SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014519001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014519001
Domain Number 1 Region: 151-335
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-46
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014519001
Domain Number - Region: 20-83
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000392
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014519001
Sequence length 374
Sequence
MADWSKGCVRSTPLDCQKGDGFVKYSGVKLPDTRNSWFDESMNLKECASLCLRNCSCTAY
ANSDIRGGGSGCLLWFDDLIDIRDFTQNGQEFYARMAASESEASSSINSSSKKKKKQVIV
ISISITGIVFLSPVLILYVLKKRKKQLKKKDHMRSRVLDWPKRFLIINGIARGLLYLHQD
SRLRIIHRDLKAENILLDNEMSPKISDFGIARSFGGNEIEANTTRVAGTLGYMSPEYASE
GLYSTKSDVFSFGVLLLKIVSGKRNRGFSHPGHDLNLLGHAWTLYIEGGSLEFIDTSKVN
TCNLFEVLRSINVGLLCIQRFPDDRPSMHSVILMLGSEGALPRPKEPCFFTDRNMMDANS
FSGIQPTITLLEAR
Download sequence
Identical sequences GSVIVT01014519001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]