SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014529001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014529001
Domain Number 1 Region: 487-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-80
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 73-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-28
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014529001
Domain Number - Region: 343-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000667
Family Anti-platelet protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014529001
Sequence length 818
Sequence
MDSLTTVAVIFSYVLSLLRISVAVDTIIVNQNITDGETITSAGGSFELGFFSPGNSKNRY
LGIWYKKVATGTVVWVANRESPLTDSSGVLKVTEQGILVLVNDTNGILWNSSSSRSAQDP
NAQLLESGNLVMRNGNDSDPENFLWQSFDYPCDTLLPGMKFGWNRVTGLDRYLSSWKSTD
DPSKGNFTYGIDLSGFPQPFLRNGLAVKFRAGPWNGVRFGGIPQLTNNSLFTSDYVSNEK
EIYSIYYLVNSSVFVRRVLTPDGYSRRFTWTDKKNEWTLYATAQSDDCDNYAICGVYGIC
KIDESPKCECMKGFRPKFQSNWDMADWSNGCIRSTPLDCQKGDGFVKYSGVKLPDTRNSW
FNESMNLKECASLCLRNCSCTAYANSDIRGGGSGCLLWFGDLIDIRDFTHNGQEFYVRMA
ASELEASSSIKSSSKKKKKHVIIISISTTGIVLLSLVLTLYVLKKRKKQLKRKGYMDHNS
RDENNEGQAHLELPLFDLDTLLNATNNFSSYNKLGEGGFGPVYKGILQEGQEIAVKMMSN
TSRQGLKEFKNEVESIAKLQHRNLVKLLGCCIHGRERMLIYEYMPNKSLDFFIFDQMQSV
ALDWSKRFLIINGIARGLLYLHQDSRLRIIHRDLKAENILLDNEMSPKISDFGIARCFGG
NETEANTTRVAGTLGYMSPEYASEGLYSTKSDVFSFGVLVLEIVSGKRNRGFNHPDHDLN
LLGHAWTLFMEDRSSEFIDASMGNSCILSEVLRSINLGLLCVQRFPDDRPSMHSVALMLG
SEGALPQPKEPCFFIDRNMMEANSPSGIQSTITLLEAR
Download sequence
Identical sequences E0CT03
GSVIVT01014529001 XP_010644306.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]