SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014532001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014532001
Domain Number 1 Region: 52-161
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-27
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014532001
Domain Number - Region: 322-365
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00271
Family Anti-platelet protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014532001
Sequence length 454
Sequence
MALDTIIVNQPITDGETITSAGGSFELGFFNPGNSKNRYLGIWYKKASKKPVVWVANRES
PLTDSSGVLKVTQPGILVLVNGTNGILWNSTSSRSAQDPNAQLLDSGNLIMRNGNDSDPE
NSLWQSFDYPCDTLLPGMKFGWNRVTGLDRHLSSWRSADDPSKGNFTYGIDLSGFPQLLL
KNGLAVAFRPGPWNGIRFSGIPQLTINPVYSYEFVSNEKEIYFMYHLVNSSVVMRNVLTP
DGYSRRFTWTDQKNEWSLYSTAQRDDCDTYAICGVNGICKINESPKCECMKGFRPKIQSN
WDMADWSNGCIRSTRLDCQKGDGFEKYSGVKLPDTQSSWFNESMNLKECASLCLSNCSCT
AYANSDIRGAGSGCLLWFGGLIDIRDFTQNGQEFYVRMAASELEASSSINSSSKKKRKQV
IVISISIIGIVLLSLVLSLYVLKKRKKQLKRKGK
Download sequence
Identical sequences GSVIVT01014532001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]