SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01015035001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01015035001
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-44
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 766-829
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000108
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01015035001
Sequence length 878
Sequence
MKAPPNGFLAGSGEGERKSINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TECVPSYPNLPSKLICMLHNVTLHADAETDEVYAQMTLQPVSKYDKEALLASDLGLKQSR
QPVEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVARDLHDNTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVIS
CDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMF
ETEESGVRRYMGTITGISELDAARWKNSQWRNLQVGWDESTAGERPSRVSIWEIEPVVTP
FYLCPPPFFRPKFPKQPGFPDDESDIESAFKRGMPWLGDDFGMKDAPSSIFPGLNLVQWM
SMQQNNQFPASQSGLFPPMVSSTVLHSNLSTDDPSKLLSFQAPALSAPSLQFNKVNQQNQ
LFQPAFVNGVFSLLVGIHFSCHLCHKTCSFSNKWNSSLAFSSQRPQQPQQPQVQQSSQQN
LPEHQLQLQYLQKLQQQQLLSPVSPRLQPQQPQQQQANQQNQSLQHLSLSQQQLSSNSFS
TSALMQSQQIPMNQLQGQHKPITAIRAHSGLTDGDAPSCSTSPSTNNCQVPSNFLNRNQQ
GPAILLGDSVVEPASNLSNPQSNPPFAVNIDGLTPDTLLDIETELSTAAISSQSFGVPNM
SFKPGCSNDVAITETGVLSNGLWTNQAQRMRTYTKVQKRGSVGRSIDVTRYKGYDELRHD
LARMFGIEGQLEDPQRTDWKLVYVDHENDILLVGDDPWEEFVSCVQSIKILSSAEVQQMS
LDGDLGHVPVPNQACSGTDSGNAWKGHYEDTSAASFNR
Download sequence
Identical sequences GSVIVT01015035001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]