SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01019562001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01019562001
Domain Number - Region: 152-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0863
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01019562001
Sequence length 203
Sequence
MGCSSSKRIEATVDVYRPAPASFAVFDINTIEEPWLKVDHAPEHHQEKPTHLPPLILEKL
NALEEGPRSWDEVSRALEDLKPTLHSPAPAPQATRKSLSFHTVAELDTKLSSKPTESTRT
ELKKTESIRINSKKPESRDAAAAKRGVGRQGCEGCGGARFVPCLECGGSCKVMVGETKER
CSECNENGLVQCPAYFYYTIIKY
Download sequence
Identical sequences GSVIVT01019562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]