SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01020563001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01020563001
Domain Number 1 Region: 11-119
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-28
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Domain Number 2 Region: 762-845
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-17
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  GSVIVT01020563001
Domain Number - Region: 286-337
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000137
Family Hairpin loop containing domain 0.044
Further Details:      
 
Domain Number - Region: 1136-1231
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000288
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 
Domain Number - Region: 1013-1059
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000902
Family Hairpin loop containing domain 0.054
Further Details:      
 
Domain Number - Region: 423-484
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00656
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01020563001
Sequence length 1246
Sequence
MWYGRLPTKTVVWVANRDQPLSDPSSSTLQLSHDGRLVLLKESRTEIWSTDVNSTTPNST
IAVLLDNGNLVVRGRSNSSSVLWQSFDHPTDTWLPGGKIGDSKHGKGKIVLTPWRSPENP
ATGIFSVDVGPNGTSHILLWNHTKIYWSSGEWTGKNFVNVPEIDKNYYVKNFRHVKTENE
SYFTYDAGVPTAVTRFLLDYTGQLKQFVWGEGFTQWTIFWTRPTLQCEVYGFCGAFSSCN
NQKEPLCECMQGFEPTVLKYWELEDHSDGCVRKTPLECGNGGNDTFFVISNTVFPVDSEN
LTVTTSEECEKACLSNCSCTAYAYDNGCLIWKGDLFNLRKLQDDNEGGKDLHVRIAASEL
VETGTNTTREKATTEKVTWILIGTIGGFLLLFGILLVVFCRRHRRPNKALEASDDSLVLF
KGDDVLTLLDSRLEGNATMEELTRACKVACWCIQDNEKDRPTMGQIVQILEGVSEVGTPP
MPRFLQNLSGNPADGSENMVLGYLPVSDYILHLSRLQVKDRVLFLIRTSKQELLNPLGGH
ARKGYESATQNKLSICQFHHVPTKMKVDLMHKKIHRKTSKVKKFRVSNNWAFLSPGHSSL
IHLLPHYNFPMMGSWSYSSSPKAEIWAINVNSDTSNSTISVLLEDETLVVRGSGGNANME
GHARACKVACWGNQDDEKDRPTMRQMVQILEEVSEVKIPKELANINAKKGKIGKKTRQRK
KSLLPLGLWMGFFWIIYLFLRSNLTCFNQFSHQMPVKLWRKLVLLTQSRTEIWSTNVSSN
IPNSTVSVLLDNGNLVVRGNSNSSSVAWQSFDHPTDTWLPGGRIGYSKLTNEKIFLTPWR
NPENPAPGIFSIEVELNGTSHVLLWNHTKMYWSSGEWTGKNFVNAPEIERDYYIKNYRYV
RTENESYFTYDAGVPTAVTRLLVDYTGQFKQFVWGKDFTQWTILWMRPTLQCEVYGFCGA
FSSCNTQKEPLCECMQGFEPTMLKDWQLEDHSDGCVRKTPLQCGNGGNDTFFVISNTAFP
VDPEKLTVPKPEECEKTCLSNCSCTAYAYDNGCLIWKGALFNLQKLHADDEGGRDFHVRI
AASELGETGTNATRAKTTREKVTWILIGTIGGFFLVFSIVLILLHRRQRRTFGPLGAGDN
SLVLFKYKDLQRHNFLTLLDKRLEGNADMEDLTRACKVACWCIQDDEKDRPTMGQIVRVL
EGVYEMGTPPIPCFFQQFFPRNTADSAIIYQEVSSSSNSYLSMSLK
Download sequence
Identical sequences GSVIVT01020563001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]