SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01020793001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01020793001
Domain Number 1 Region: 105-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.24e-25
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 2 Region: 362-416
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000143
Family Protein kinases, catalytic subunit 0.0069
Further Details:      
 
Weak hits

Sequence:  GSVIVT01020793001
Domain Number - Region: 281-319
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00286
Family Hairpin loop containing domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01020793001
Sequence length 542
Sequence
MGISRILGCLLGCHILFIPFSLPVNALTAYDSAANLSSSWINNGSRDIGVDSEDYSTLRP
IFLGQGINASFACGFYCNYNCEGYLFAILIFPPPGKYNYPEVRNPKVVWSANQNFLVRDD
ATLQLTQDGDLILRDADGTLVWCTYTYGKSVVGLNLTETGNLVLFDSNNASVWQSFDHPT
DSLVPGQILVLGQKLIATVSNKDWSQGLISLVVTEYGQCFCPGPTAGETRYFTPVNDEEP
DLGCKEITPLSCNASHYQSLLMLRSTTSALILQLNKTEIGNETESDIESCKQACLSNFSC
KAAVFLSGVENGGACYLLSEIFSLMKDAPFVGLVFIVIIIGRYLILKGKDVKEDGEDKDL
LQVPGMPTRFSHEILVAATENFSRELGKGGFGSVFEGILTDGTKVAVKCINDQMLDLVDK
YSEDMQLHGEEAVELMMLAAWCLQNDNDNLDYNFLNSSGLGATEAVHRREINVGFASPVQ
CNIILTHKIRSIYIHIDDNKKMYIDNETSTLTYIDNFGTLIYDHGYSWVLMTRTRINCIK
KV
Download sequence
Identical sequences GSVIVT01020793001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]