SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01020794001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01020794001
Domain Number 1 Region: 13-395
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.96e-115
Family Galacturonase 0.00015
Further Details:      
 
Domain Number 2 Region: 499-575
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-25
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Domain Number 3 Region: 867-961
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-20
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Weak hits

Sequence:  GSVIVT01020794001
Domain Number - Region: 770-809
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000334
Family Hairpin loop containing domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01020794001
Sequence length 1080
Sequence
MGLKLNIATTSLLLLLASAAEVSGDIIFDVTKYGARTDGNSDISQALLKAWGDACSSPVA
STVMIPDGTYALGQIIIAGPCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLS
GDGVFDGQGKIVWGTKCLSSAYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKN
LTFYNIVISAPQESLNTDGIHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGP
GHGISVGSLGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNN
VGNPIIIDQEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVEL
GDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRISMGISRILGCLLGCHILFIPFSLPVNA
LTAYDSAANLSSSWINNGSRDIGVDSEDYSTLRPIFLGQGINASFACGFYCNYNCEGYLF
AILIFPPARIHNFLEVQDPKVVWSANQNFLVRDDATLQLTQDGDLILRDADGTFVWSSNT
SGKSVVGLNLTEIGNLVLFDSNNASVWQSFDHPTDSLVPGQILVFDQKLTASASNKDWSQ
GLISFFITNYSVVALIGSHNYFFHSHGYHNGTESRYVIFRKEGLLFPSAQPVFSFPGPFS
AQYMKLEPKGYLTFYGFFNDIWKVLFNPLLGDFNCAYPMICGKYGVCSEQQCFCPGPTAG
ETRYFTPVNDEEPDLGCKEITPLSCNASHYQSLLMLRSTVSALILPNKFEIFNKKESDIE
SCKQACLSNCSCKAAVFWSSHGACYLLSEIFSLMKDAHPPGLTTFIKLLSPFGAFVGLVF
IVIMIGRYLILKGKDVKEDGEDKDLLQVPGMPTRFSHEILIVATENFSRELGKGGFGSVF
EGILTDGTKVAVKCINGLSQTKDYFLAEVETIGGIHHLNLVRLVGYCANKSNRCLVYEYI
NLDHSQPEEDKYLLSLFKRKAEEDQMLDLVDKYSEDMQLHGEEAVELMRLAAWCLQNDNG
RRPSMSMVIKVLEGVIDVEDNLDYNFFNSSGLGATEAVHRREINVGFASPVLPSILSGPR
Download sequence
Identical sequences GSVIVT01020794001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]