SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021452001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01021452001
Domain Number - Region: 159-216
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00106
Family Pan module (APPLE domain) 0.05
Further Details:      
 
Domain Number - Region: 86-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021452001
Sequence length 233
Sequence
MGSKWIWRMGPWNCLGFVGVPEMLTTFIFDIRFWNTGDEVSMEFTLVNSSTFSSIKLGSD
GLYQRYTLDERNRQLVAIWSAARDPCDNYGRCGLNSNCDVYTGAGFECTCLAGFEPKSQR
DWSLRDGSGGCVRIQGTNTCRSGEGFIKIAGVKPPDASTARVNESLNLEGCKKECLNDCN
CRAYTSADVSTGGSGCLSWYGDLMDIGTLAQGGQDLFVRVDAIILGMRSYLQN
Download sequence
Identical sequences D7TK53
GSVIVT01021452001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]