SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021671001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021671001
Domain Number 1 Region: 457-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-75
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 1181-1465
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 1064-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000573
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 306-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000355
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021671001
Domain Number - Region: 1026-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00429
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021671001
Sequence length 1500
Sequence
MALQVIQVHLVTIIISIISLVFSLKETKASTAKPGCPETCGNLAIVYPFGIGEGCYLDKR
FEITCNNSSNPHPVLRLDQKKEAEVLDMSLEHVRIRDWTSPLCYANNALEGKSYSQFTLA
PPMEPFSYSHTENKLIGIGCDIFAYIGDFHSTNSSIKNFISGCVSICNGQGWSWLDTNYS
CSGIGCCQTTFPYDLPNFDVRVGNMSIWQEAKDWSSNQCCIVLIAENNFSGFHQFDISFS
NQNMKYFYPAVLKWEIGNKSCHETQKRGDYACGRNSHCINSKKGSGYRCLCNPGYRGNPY
LPDGCIDVDECMESNNTLCQKGAVCTNKNGSYYCDCPPGYYRDDDKPEYECVRNKGKLKP
ALLVSSGITFSQCLPHVHPLLALEFVVNYVPLWLIHAGIVVTLVLLILPSIGFWLNQELE
KRKKSKLKQMSFKKNGGLLMQQQISSSSIGSSVEKTKLYTIGELEKATDNFNAGRVLGKG
GRGKVYKGMLLDGSIVAIKKSIVVDERQVVEFINEVFILSQINHRHIVKLLGCCLESEVP
LLVYEYISNNTLSHHLHNEDHASTLSWEKRLRIADEIAGALAYLHSYASTAILHRDIKSR
NILLDENFRAVVSDFGLSRLIAHEKTHLSTLVQGTFGYLDPEYFRSGQFTDKSDVYGFGM
ILAELLTGEKVICSSRSEESLAIHFRLAMKQNCLFEILDKVIVNEGQKKEILAVAKIAKR
CLKLSGKKRPAMKEIAADLHQLRTMKQPSLQQTCQDNCSVSERYSISSASTIILDHPVTI
IILLLFSSKETAASMAKPGCQETCGNVGIVYPFGIGRGCYHDKNFEVSCAYSSNPPRPSL
VVLQVEVLKTSPDNVRICDWTVAACYFDYTSQAASAFTPMEPYSYSHAENKFIGIGCDIG
AYIGELNRTSRSLTRYAGGCVSVCHIPGGQAWSNRTSCSGIRCCQTTFSNDLSNVDLWLT
NMSMWSKAMAGSNSNPCSFAIIAEKNFSDFDRFDTTLSGENKTYFYPAILNWAIGNKSCQ
EARKRSHYACGSNSRCVDSDQGSGYKCRCSQGYRGNPYLQDGCIDINECMDPNNTLCKKG
AVCINTYGGYYCACPPGYHSHDSQPEHGCVRDKVKLKAAILVTSGIGIAVVLLILLAVGF
WLHRQLEERKKNKLKQKLFKRNGGLLLQQQITSSGKGSVEKTKLYTIEELEKATDNFNAS
RVLGRGGHGTVYKGMLLDGSIVAIKKSIIVDERQVVTFVNEVFILSQINHRHIVKLLGCC
LESEVPLLVYEYVSNSTLSHHLHDRNCESKLSWEKRLRIADEIAGALAYLHTYASPAILH
RDIKSSNILLDEHFRAVVSDFGLSRSITHEKTHLTTLVQGTFGYLDPGYFRSGQFTDKSD
VYAFGVVLAELLTGEKVICSSRSEASLATHFRLAMKQNYLFEILDKVILDDGQKEEILAV
ARLAKICLKLGGKKRPTMKEIAADLDQLRRTTEQPSLQRTCQDNCSLQLDIKRFVKQIHV
Download sequence
Identical sequences GSVIVT01021671001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]