SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021675001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01021675001
Domain Number - Region: 270-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00718
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021675001
Sequence length 321
Sequence
MALQVIQVHLVTIIISIISLVFSLKETKASTAKPGCPETCGNLAIVYPFGIGEGCYLDKR
FEITCNNSSNPHPVLRLDQKKEAEVLDMSLEHVRITDWTSPLCYANNALEGKSYAQFTLA
PPMEPFSYSHTENKLIGIGCDIFAYIGDFHSTNSSIKNFISGCVSVCNGQGWSWIDTSYS
CSGIGCCQTTFPNDLPNFYVRVGNMSIWQEARDWSSNQCGIVLIAENNFSGFHQFDISFS
NQNMKYFYPAVLKWEIGNKSCHETQKRGDYACGRNSRCVNSKKGSGYRCLCNPGYRGNPY
LPDGCIEILIKKKLLISFAQS
Download sequence
Identical sequences D7TKL2
GSVIVT01021675001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]