SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021682001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021682001
Domain Number 1 Region: 433-710
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-57
Family Protein kinases, catalytic subunit 0.00043
Further Details:      
 
Domain Number 2 Region: 314-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000522
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021682001
Domain Number - Region: 278-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00679
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021682001
Sequence length 738
Sequence
MALSLSPIFILIRKKIPFNLIIGYSQLLIGHLAAIIIIILLFSSKGTAASIAKPGCRETC
GNVRIVYPFGIGRGCYHDRNFEVSCDNSSNPPRPCLVVIETEVLQTSLDNVRIIDWVSPS
CHISSTKGMGMGFYSMEPYSYSHAENKFIGIGCDIGVYIGELNITNPSQTRYAGGCVSVC
HIPGGQPWSNRTSCSGISCCQTTFSNDLSSIDLWAVNISIRSTSNPCSFAIIAEKNFSDF
DQFDTTLSGENKTYFYPAILNWAIGNKSCQEARKRSDYACGSNSRCVDSDKGSGYKCRCS
RGYHGNPYLRDGCIDIDECIDSNNTLCKKGAACINTYGGFYCACPPGYHSYDSKPEHGCV
RDKVKLKAAILVTSGIGITVVLLILLAVGFWLHRQLEERKKNKLKHKFFKRNGGLLLQQQ
ITSSSKGSVEKTKLFAIEELEKATDNFNASRVLGKGGHGTVYKGMLLDGSIVAIKKSIIV
DERQVVEFVNEVFILSQINHRHIVKLLGCCLESEVPLLVYEYVSNSTLSHHLHDKNRESK
LSWEKRLRIADEIAGALAYLHSYASPAILHRDIKSSNILLDEHFRAVVSDFGLSRSITHE
KTHLTTLVQGTFGEKVICSSRSEESLATHFRLAMKQNCLFEILDKVILDEGQKEEILAVA
RLTKICLKLGGKKRPTMKEIAADLDRLRRTVEQQSLQRTCQDNSSVSVRSYTYASTSAVT
EEYILEDEDYPKPYRMTT
Download sequence
Identical sequences GSVIVT01021682001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]