SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021694001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021694001
Domain Number 1 Region: 217-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-76
Family Protein kinases, catalytic subunit 0.0000968
Further Details:      
 
Domain Number 2 Region: 66-148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021694001
Sequence length 517
Sequence
MQTTGFKSETEDICGYAFIAQTNFPVSYTISSSRKIVPVSEVVPAVLEWTVGNISCHEAK
GREDYACGYNSSCVDSTQGSGYKCKCLIGYRGNPYLPTGCEDVDECKEPKNNICHEIARC
VNIPGNYSCICPDGYHGDATKFGSGCIPVKGKLPVPLVVSLGIGIAVGLLILLAIAFWLY
KRLEKRKKDILKRKFFDENGGRLLRHMMALSKGSVEKMKLYIIEELEKATDNFNVNRILG
KGGFGTVYKGMLQDGSIVAVKKSDKVDEMQVDQFVNEVFILTQIDHSHIVKLLGCCLETE
VPLLVYEHVSNGTLSHHLHDKGHLSTLSWENRLRIASEIADALDYLHSYGSAAIFHRDIK
SNNILLDENLRAIVADFGISRPVSAKKTHLTASVLQGTYGYLDPEYFQTWQFTSKSDVYA
FGVLLAELITGEKAICADRDKQGLASHFTSAMKSNDLFEIVDHTLVLNEDQKEEILVVAR
IAERCLEPTGDKRPTMKDVAGGLPKLRKIFLEQQVVE
Download sequence
Identical sequences D7TKM4
GSVIVT01021694001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]