SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021970001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021970001
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily PapD-like 1.13e-39
Family MSP-like 0.0032
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021970001
Domain Number - Region: 252-308
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00811
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021970001
Sequence length 336
Sequence
MYSELVDIQPRELKFTFEVKKQSSCSIRLVNNTYHHVAYKVKTTSPKKYCVRPNTGVLKP
NSTCDFTVTMQAQRSAPPDMICKDKFLVQSTIVPAGTSDEDITPGMFSKDSGKYIEENKL
RVILISPPNSPVLSPINGALTQVPVYEASLPKDEVLSRVKIVTPHHVVAKDEESEMLDEE
LKPAAELVDEELKPAAKLVDDKELKPVAQKVDTEELKPMAQKVDEEFKTAAQVAQMVDDM
ESKQARDVEELKLVKDIEEMKSKLNQLESKLSEAEVTISKLTEERRLTIQERENLQQELA
VFQSKRSGRRAQAGFPLLFVCMVALVSIMLGYLCHS
Download sequence
Identical sequences D7TUW5
XP_002266266.1.54126 XP_010659989.1.54126 GSVIVT01021970001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]