SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01022143001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01022143001
Domain Number 1 Region: 134-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-24
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01022143001
Sequence length 508
Sequence
MGVDQNVVKQEVEDEVFRMASSRESRRSREEDVTLAQLSQTVRTFAPSTPQSLTKIKLKS
STRTKQKKCVEKKEKGFGIKRRRSTFKLKHEASDHSPKSASRKRNKAAVDGSCTPLKAKT
SALIRAEEVQSNLGPEFPSFVKVLVRSHVSSCFWMGLPGPFCDMHLPKKDVIITLEDESG
AACQIKYIADKTGLSAGWRRFSMDHKLLEGDVLVFHLVEPTSFKVYIIRANDLTEVDGAL
GLLELDTHTKNDAGKLVAVSVIADLDTVACKSSKRKHSKSLPLVVFQKKNRKTGSIPNLM
QREQSENDSEGNGSEVLEGSKFFEPAVQFKDISFDNFNILVDGLLIDSELPEDTRAKYYE
LCCSQNAFLHEKIVEGLNCRLIAEIISQTVQIADALRACKLTTSRVEFTNWERTLKAFEV
LGMNVGFLQARLDHLVSLAFDSEGAMYSRQYMEVTIERAHAEDEMRDLEDKLMELKAASE
RMDADIETLKEAVENHVIRFQEEIVAPW
Download sequence
Identical sequences GSVIVT01022143001 XP_019076667.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]