SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01023582001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01023582001
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000621
Family GCC-box binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 167-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000222
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01023582001
Sequence length 242
Sequence
MEEEILSVISNGGTNVIVEASDSNSSSLPFHGSKRTKQGISVSSGRFKGVVPQQNGHWGA
QIYANHQRIWLGTYKSETEAAMAYDSAAIKLRSGDNHRNFPWTNLTIQEPNFQSFFSTET
VVNMIKDGSYPSKFAEFLKTESQRGETEVLSLDQVGVHRNGRFMCRLLFQKELTPSDVGK
LNRLVIPKKYATKHFPPISESAEENEVGMNLPTKILPISTRDPVMQLHFCLNCGVNVLPN
AV
Download sequence
Identical sequences GSVIVT01023582001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]