SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01025159001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01025159001
Domain Number 1 Region: 159-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-44
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 666-749
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000338
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01025159001
Sequence length 798
Sequence
MEIDLNHAVTEVEKHAFCNGDCDKASCVCCLSSSSSSSSASNSSASPDSSSIYLELWHVC
AGRLTSLPKKGNVVVYFPQGHLEQAASSSPFPPMDISTFDLPPQIFCRVVNVQLLANKEN
DEVYTQVTLLPQPELAGINLEGKELEGLGVDEEGGGGSPTKSTPHMFCKTLTASDTSTHG
GFSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFV
SQKNLVSGDAVLFLRGEGGELRLGIRRAVRPRNGLPDSIIGNQNSYPNVLSLAANAVATK
SMFHVFYSPRASHAEFVIPYQKYVKSITNPISIGTRFKMRYDMDDSPERRSSGVVTGIGD
LDPYRWPNSKWRCLMVRWDDDIVSDPQERVSPWEIDPSVSLPPLSIQSSPRLKKLRTSLQ
ATPPNNPINGGGGFLDFEESVRSSKVLQGQENVGFVSPLYGCDKVNRSLDFEMQNPSLAS
TGIEKANFCEFMRAPPTTYTGFLESDRFPKVLQGQEIGPLRSLAGKSDFNLGSWGKPNLG
CNLFNMYQKPKPNFYPLASEGIRNMYFPYNDIYKGGQDPVMLSYASNFPRENVPFNPSSI
RSGVIGTEVRKLNIPNEPKPPENISAPPNLETNLKHQKDDTFSGTAAGCKLFGFSLTGET
PPNSQNSGKRSCTKVHKQGNLVGRAIDLSRLNGYGDLFSELERLFGMEGLLRDPDKGWQI
LYTDSENDMMVVGDDPWHEFCNVVSKIHIYTQEEVEKMTIGIISDDTQSCLEEAPVILDV
SKSSSVGQPDSSPTVIRI
Download sequence
Identical sequences D7SKV9
29760.GSVIVG00024505001 GSVIVT01025159001 XP_002285019.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]