SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01025198001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01025198001
Domain Number 1 Region: 68-138
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-18
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  GSVIVT01025198001
Domain Number - Region: 437-507
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0275
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01025198001
Sequence length 546
Sequence
MKETEKSLDSQLWHACAGGMVQMPLVSSKVFYFPQGHAEHAHTNVDFAAAPRIPALVLCR
VAAVKFMADPETDETVIAKDVHGEIWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSI
VFLRAENGDLCVGIRRAKRGIAGSGGGLRGGRRVRPESVVEAATLAANGQPFEVVYYPRA
STPEFCVKASGVRSAVRIQWCSGMRFKMPFETEDSSRISWFMGTISSVQVADPIRWPNSP
WRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPIIHLSPFSPPRKKLRIPQHPDFPFDGQF
PMSSFSSNPLGSSSPLCCLPDNTPAGIQGARHAQYGISLSDLHLNNKLQSGLKNNESISC
LLTMGNSSQNLEKSANEKTPQFLLFGQPILTEQQMSRTCSSDAVSQVLTGKKNLSNVGFS
WHQGFQTTEIGLDTGHCKVFMESEDVGRSLDLSVLGSYEELYTRLANMFGIERSETFSHV
LYRDATGAVKHTGDEPFSDFTKKAKRLTILMDSGSNNIGRTWITGMRNAENGLDSSNKTG
PLSIFA
Download sequence
Identical sequences GSVIVT01025198001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]