SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01025346001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01025346001
Domain Number 1 Region: 1060-1349
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 542-831
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-70
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 3 Region: 198-341
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.06e-23
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  GSVIVT01025346001
Domain Number - Region: 303-395
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000822
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Domain Number - Region: 431-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00932
Family Merozoite surface protein 1 (MSP-1) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01025346001
Sequence length 1367
Sequence
MSASYYLRSRVELATGGQFVLNDPEGKQIWNAVYASKSNIFLGSSLTAMNNSFFLAPPSG
EFDFRFQQIRAGGFLIASWGKKIPEKTIVWSANGNNLLNGCSRNIHLQWYKLRFDFCNSY
QIFSFSLFKKIFSFYMDFSLPSALPLLITFLLPFLSIAQIYSNITLGSSLTALDNNSFWA
SLSGDFAFGFQQIGGGGFLLAIWFNKVPEKTIIWSSNRNNVVQSGSKVQLTTDGLFVLTD
STGEQVWMADPAVAYAAMLDTGNFVLASQDSTNLWESFDHLTDTLLPTQMLNQGSKLVAR
SSDVSYSSGRFMFALQTDGNLVMYTTDFPMDSANFAYWSTQAIGSGFQVIFNQSGHIYVV
VRKESILSDALSNEVSMRDFYQRAILEYDGVFRQYVYPKTAGSRSGRWPMAWSTLSSFIP
DNICRIIRADTGSGACGFNSYCTQEDDKTLHCQCPPGYSFLDQKNEMKGCKQDFVPESCD
EKSQKMGLFHLEEITNVDWPLSYYEYFQPLCFLNLLLLLATIIFIFLLNHRKSKILQPHP
VMVGRNLQIFTYNKLEEATNGFKDQLGRGAFGTVYKGVLNHENGNFNAVKKLDKMVKEGE
QEFETEVKAIGRTNHKNLVQLLGFCNEGQNRLLVYKFMSNCSLATFLFGNSRPNWYKRIQ
IVLGTAKGLLYLHEECSTQIIQCDIKPQNILLDSFLTARISDFGLAKLLKTDQTQTMTAI
RGTNGYVAPEWFKTVPITFKVDVYSFGIVQLELIFCRKNFEPELEDEYRMVLAEWAYDCY
HKGKLDLLLENDQETLNKMEKLEKFVMIAIWCIQEDPSRRPTMKKVIQMLEGAIQVPLPP
DLSSWPMAWSPSPSIPGNICMRITENTGGGACGFNSYCILGDDQRPNCKCPTGYDFLDQS
DKMSGCKQNFVTQNCDQASRETDQFYFQEMPNTDWPLSDYGYFQPVSEDWCREACLTDCF
CAVAIFRDGNCWKKKIPLSNGRIDPSVGGKALIKLRQGNSTTKPGDGDSNKKHQSTLILT
GSVLLGSSVFLNFLFFLATVLFIFRFNNRKTKMLHTYLSTLGMNLRSFTYNELDEATDGF
KEELGRGAFATVYKGVLAYEKGKLVAVKKFEKMMRENEQEFQTEVKAIGQTNHKNLVQLL
GFCKEGEHRLLVYEFMSNGSLEKFLFGNSRPNWHKRIQIAFGIARGLFYLHEECSTQIIH
CDIKPQNILLDDSFSARISDFGLAKLLKTDQTRTTTGIRGTKGYVAPEWFKSMPITVKVD
VYSFGILLLELICCRKNLEFEAKDETQMILADWAYDCYKGGLLEVLVGYDQEAIVEMKRL
EKFVMIAIWCIQEDPSLRPTMKKVTQMLEGAVEVSVPPDPCSFISSI
Download sequence
Identical sequences GSVIVT01025346001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]