SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01025347001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01025347001
Domain Number 1 Region: 262-450,510-542
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.22e-29
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 2 Region: 615-693
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-17
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Domain Number 3 Region: 1-86
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000166
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Domain Number 4 Region: 695-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000542
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 
Weak hits

Sequence:  GSVIVT01025347001
Domain Number - Region: 145-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.09
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01025347001
Sequence length 804
Sequence
MLDTGNFVLASQESSNLWESFSHPTDTILPTQILNLGSQLVARFLETNYSNGRFMFALQS
DGNLVLYTTDFPMDSNNFAYWSTQTMDSGFQVNMREDFYQRAILEYDGVFRQYVYPKSAA
SGTMAWSSLSKFIPENICTRIGASTGGGACGFNSYCRLGDNQRPSCHCPPGYTWLDPLDS
LGGCRQNFVQQRCDAGTQEAGLFYFSEMLGVDWPYADYQHFKGVTQDWCRQACLGDCFCA
HRKTSVLQTSPAMEGTNLRSFTYEELEEATNGFRDELGSGAFATVYKGALPHDDGINLIA
VKKLERMEKEGDKEFGAEVKAIGRTNHKNLVQLLGYCNEGQHRLLVYEFMSNGSLATFLF
GNSRPDWWKLGHIARGLGHDVKYLKKNCWPTSLAIGFQPEMLLLRSKLLARLSETNYSSG
RFMFTLESTGNLAMYTTNFPQDSENFAYWSSKTTGSGFQVIFNQKNFAPDVRDESQMILA
DWVQDCYKEKRLDLLVGNDEEAFGDMEKLEKFVMIAIWCTQEDPSRRPTMKKVVQMLEGA
AEVSIPPDSSFSSASILKVKSGDFIISNLLRLEISSTAHGLIWPRGYDVEYLEKNCWPTS
LAIGFQLERILLLKKGSKVQLTSDGNFVLNDQEGEKIWPVDSTITGVAYAAMLDSGNFVL
VRQDSINLWESFDNPTDTILPTQALNQGSKLCWEAYGMVLFNLLIFCRKNFEPAVEDENQ
MVLADWAYDSYLERKLDLLVEKDQEALDNMEKLEKFVMIAIWCIQEDPSQRPTMKKVTQM
LEGAIEVPLPPDPSPFSKSFPHQP
Download sequence
Identical sequences GSVIVT01025347001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]