SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01025348001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01025348001
Domain Number 1 Region: 94-241
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.86e-28
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  GSVIVT01025348001
Domain Number - Region: 556-588
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00439
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 
Domain Number - Region: 327-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01025348001
Sequence length 596
Sequence
MVLPVTVCTEIIESCRSFRCFSSLNMAPTLPCNHPLCYLLLLLLLLLKPVSSYAQTSGKF
SLGSSLTAQKNDSFWASPSGDFAFGFQQIGNGGFLLAIWFNKVPEKTIIWSANSDNPKPR
GSKVELTTDGEFILNDQKGKQMWKADLIGPGVAYAAMLDTGNFVLASQNSTYLWESFNHP
TDTILPTQILEQGSKLVARYSETNYSRGRFMFSLQTDGNLVLYTTDFPMDSANFAYWESD
TVGSGFLVIFNQSGNIYLIGRNGSILNEVLPNKASTPDFYQRGILEYDGVFRQYVYPKTA
GSRAGGWSSLSSFIPENICTAITAGTGSGACGFNSYCTLGDDQRPYCQCPPGYTFLDPHD
QVKGCRQNFFPEICSEGSHETGEFDFVRMTNVDWPLSDYDRFQLFTEDECRKACLDDCFC
AVAIVREGDCWKKKFPLSNGRFDSSNGRIALIKVRKDNSTFPLGSEGKDQATLILTGSVL
LGSSVLLNILLLLATAMFIYRLNQRKPMIDESRLVMLGTNLKRFAYDELEEATDGFKDEL
GTGAFATALDDIKRLEKFVMVAFWCTQEDPSQRPTMKTVMKMLEGATEVPTQFSIT
Download sequence
Identical sequences GSVIVT01025348001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]