SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01026125001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01026125001
Domain Number 1 Region: 255-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-23
Family Protein kinases, catalytic subunit 0.0029
Further Details:      
 
Domain Number 2 Region: 150-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  GSVIVT01026125001
Domain Number - Region: 358-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0118
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number - Region: 120-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01026125001
Sequence length 462
Sequence
MGYFWRVLKMSLIIRLMFVAATAAAQEAKPGCQESCGNISIPYPFGTSPECYIAEEFLIT
CNTTNYSPPQAFLTRSNIQVLEILLQVTGYRGQNYTTGCVSLCDSVDDVINGINKYQQEN
TQCHDSISRPGYGCSCSDGYQGNPYLGCQDIDECSTLSPCNGTCQNLPGTFNCSCPKGYE
GDGRKNGTGCTLVASQSQRFPLIIILGKHIILLTSSWIYLGLRERKLIKRKEKFFQKNGG
LMLQHLLSKYEGCTETTKIFTAKDLQKATDNYHESRILGQGGQGTVYKGILPDNRVVAIK
KSKVTDQSQVEQFVNEVHILSQINHRNVVKLLGCCLETEKERHLVRLFRSAVKEDRLLEV
LDNKVLNEEHVQYFMEVAMLAKRCLEVKGQERPTMKEVAMELERVLKLIEKHPWVEGHDW
NLEETQSLLNESLKAAYGCDSSNTTGYDSLKSEVKLNIDSGR
Download sequence
Identical sequences GSVIVT01026125001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]