SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01026547001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01026547001
Domain Number 1 Region: 353-633
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-73
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000628
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 
Domain Number 3 Region: 48-145
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000563
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  GSVIVT01026547001
Domain Number - Region: 157-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0319
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 230-262
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01026547001
Sequence length 653
Sequence
MLDSGNFVLYNSKQEIIWQSFDHPTDTLLSGQRLQAGAELVSSVSEKNYSTGMFQLKMQH
DGNLVQYPTNVPEVVEYAYWASDTHGEGDNATLNLDADGYLYLLNATGFNIKNLTDGGGP
QEETIYLMKIDVDGIFRLYSRGLDQSSEWSVEWSSSIDKCDPKGLCGLNSYCSLMDQEPV
CTCLPGFDFVDKSQKSWGCERNFVAEACKNNDGSIEYSIESLQSVMWEDDSYLVISSRTE
ENCIEACLEDCNCEAALFKNSECRKQKLPSRFGRRSLSDETTAFVKVGTSTATRRAPKES
KKEWRKDILIISCSLLALACIVLAISGLLIYRNRGCTLKKVSKQGNLRLTEGATLQSFTY
QELKKVTNGFTEVLGKGGFGTVYKGAMSNGQRLVAVKKLNVSTGEKEFRTEMKALAGTHH
RNLVQLLGYCLEGPNRFLVYEYISNGSLANLLFTPAKWPRWDERMGIAQNVARGILYLHE
ECETQIMHCDIKPQNILMDEYGGAKISSFGLAKRLKHGQTSTLAEIRGTKGYIAPEWFRN
QPVTVKVDVYSFGIMLLQIICCRKNFDLSLPDEEIGLNEWVSHCFEAGELGKLVDDEEVD
KRELERMVKVGLWCIQDEPLFRPSIKKVLLMLEGSIIDIPVPPSTSTTYFSAV
Download sequence
Identical sequences D7U4I0
GSVIVT01026547001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]