SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01026549001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01026549001
Domain Number 1 Region: 514-651
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.4e-33
Family Protein kinases, catalytic subunit 0.00095
Further Details:      
 
Domain Number 2 Region: 114-246
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-21
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Domain Number 3 Region: 215-313
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000864
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  GSVIVT01026549001
Domain Number - Region: 393-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00353
Family Pan module (APPLE domain) 0.052
Further Details:      
 
Domain Number - Region: 320-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0656
Family Merozoite surface protein 1 (MSP-1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01026549001
Sequence length 652
Sequence
MYPKQIKKKGHSKQPWDFGSIEWRMKIYLYKLFKAMCIKDRESLSLMASTTLLFLLLSAF
CVAAVAQQRGSNISRGSSLTPTSNSFWLSPNRLYAFGFYKQGNGYYLGIFLIGIPQKTVV
WTANRDDPPVPSTATLHFTSEGRLRLQTQGQQKEIANSASASSASMLDSGNFVLYNSDGD
IVWQSFDLQTDTLLPGQRLSAGKELFSSVSETNPSTGMFRLKMQNNGNLVQYPVKTPDAP
TYAYYTSETGGVGDNVTLLLDGGGHLYLLNTNGSNILNITDGGYDNENLHLLKIDPDGIF
KLYSHDSGQNGSWSILWRSSNDKCAPKGLCGVNGFCILLDERPDCKCLPGFYFVVESNWS
SGCIRNFKEEICKSNDGRTKYTMSTLENTRWEEASYSNLSVPTQEDCEQACLEDCNCEAA
LFEDGSCKKQRLPLRFGRRSLGDSNILFVKMGSPEVSPHGSKKELRTDILVISVSLASFA
LIILAISGVLIRRKNLWAYKKISETGNVGLTEDVALRSFTYMELEKVTDGFKEEIGKGAS
GTVYKGAISNGRRIVAVKKLAKELAEGQREFQNELKVIGRTHHRNLVRLLGYCLDGQNKL
LVYQYMSNGSLADLLFTPGKQPRWIERMGIALNVARGILYLHEECETQIIHL
Download sequence
Identical sequences GSVIVT01026549001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]