SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01027643001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01027643001
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily PapD-like 2.28e-45
Family MSP-like 0.0012
Further Details:      
 
Weak hits

Sequence:  GSVIVT01027643001
Domain Number - Region: 174-213
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0262
Family Moesin tail domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01027643001
Sequence length 239
Sequence
MTTGDLLNIHPTELKFPFELKKQSSCSLQLTNKTDQYVAFKVKTTNPKKYCVRPNTGVVL
PGATCNVTVTMQAQKEAPPDMQCKDKFLLQSVVAPTAATAKDITTEMFNKVDGKVVEEFK
LRVVYIPANPPSPVPEGSEEGSSPRASVHENGNQNTSLFCTVKGSPEEAKEEALEAWSMV
TKLTEERASALQQNQKLRQELELVRKEISKSRAGGISLFFVVVLVGLIGILLGYFVKRT
Download sequence
Identical sequences D7U7V1
GSVIVT01027643001 29760.GSVIVG00026378001 XP_002280265.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]