SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01027683001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01027683001
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily PapD-like 6.54e-45
Family MSP-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01027683001
Sequence length 239
Sequence
MSTGELLSIEPQELQFPFELRKQISCSLQLSNKTDNFVAFKVKTTNPKKYCVRPNTGVVM
PRSTCDVIVTMQAQRETPQDMQCKDKFLLQSAIASPGATAKDITSDMFNKEAGNRVEECK
LRVAYVPPPQPPSPVREGSEEGSSPRASVSDNGNINASEFTAVSRAYVEPQDNSSEARAL
ISKLTEEKKSAIQQNNKLQQELEFLRRESNRSRNGSLSFIYFILVGLLGLLMGYLMKMT
Download sequence
Identical sequences D7U7Y2
GSVIVT01027683001 29760.GSVIVG00026421001 XP_002274894.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]