SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01030182001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01030182001
Domain Number 1 Region: 304-406
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  GSVIVT01030182001
Domain Number - Region: 571-594
Classification Level Classification E-value
Superfamily CSL zinc finger 0.0719
Family CSL zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01030182001
Sequence length 856
Sequence
MASKTCANVSCPGASSGSTIEWRKGWALRSGDFAILCDKCGSAFEQLVFCDMFHSKDSGW
RKCTACGKRLHCGCIASRSLLELLDSGGVNCINCIRSSGPHPMTGDEKANESGAMTVDNV
GEIRCTSVDNQLDGGSVEKMKLTQLGNDTSGDGLKNFLQSGNDNINGSLGQMKQEEVLPP
QGETANMMVKDIHESLVQTNLSITLGAPSGNPNVFPSAVVEEREQHKTSTPIQQGPRSRH
LLPKPPRSALSPVLETNTGIVPQIRVARPPAEGRGRNQLLPRYWPRITDQELQQISGDSN
STIVPLFEKMLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRIQDVKGKEWVFQFRF
WPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLVMGFRKASNSVSMQDTQLSA
IPNGAHSSETFFSGVIENQPIISGYSGILQSLKGSTDPHLNALSKHLNSASGDIGWHKTE
KHGGKTREGLLLPSMLVPEKKRTRTIGSKSKRLLIDGQDALELRLTWEEAQSLLRPPPSV
KPVIDVIEDYEFEAYTEPPVFGKRSIFTTLPSGGEEQWVQCDSCSKWRKVPHDYLVPCQW
TCAENLWDQSRCSCSAPDELSPRELEHILRQYKDFRKRRIAAVHRPAQEHEPSGLDALAN
AAALGDDMSDPAATSVATTTKHPRHRPGCSCIVCIQPPSGKGKHKPTCTCNVCMTVKRRF
KTLMMRKKKRQSEREAEIAQINHNIWGAKDEAEVDSTSRLATPNPDPSEMGSNRVSMMSL
LQVASLPLETYLKQNGLKSLAEQQGSSGSHVPPPQATGESEGPLNEDHCITAPAVSEREN
GGDEEHSGQDQSKNDA
Download sequence
Identical sequences GSVIVT01030182001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]