SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01030223001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01030223001
Domain Number 1 Region: 90-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-18
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  GSVIVT01030223001
Domain Number - Region: 351-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0141
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01030223001
Sequence length 465
Sequence
MKLFLFLFLLGVLIHLFAHGSCKSDLPAPSQVMLAVPVGYSVGFKGRAFLMEANQMVPSF
RAALSVEAINGKYACSLGVFLGDVKVWDSGHSTRFYTSERCALELTTDGDLQLKGAKEQV
GWRTATFGQGVERLQLSRTGNLVLVDALNRIKWQSFNFPTDVMLWGQKFDLGTRLTSFAS
NSDSFYSFEIQPNKIALYLNSGSWKHSYWEFKPSKNRNITFIELGTKGLELFNNKHKKIA
QILSQRLEPLRFMSLGNGTGNLGLYYYSSDKGKFETSFQALNTTCDLPLACEPYGICTFS
NACSCIRFVKKTEERMRSSCDEGHPRGFCGREVEMLELEGVSTVLRNDPKQVNVSREECS
SLCMDDCKCVAALYSSGKGGADVRECFLYGLVRGVKQVDRGSGFNYMVKVPKGSGGGHGR
TKNVRKWVLVMVGVVDGLIILLVLGGLGYYIIRKRRKNLATDNTT
Download sequence
Identical sequences D7SR23
GSVIVT01030223001 XP_002266325.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]