SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01030995001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01030995001
Domain Number 1 Region: 308-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-67
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Weak hits

Sequence:  GSVIVT01030995001
Domain Number - Region: 205-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01030995001
Sequence length 584
Sequence
MPPNFFPAYSVFLMIMLIPVPRVVCEDNQQFVSCGAQYECGNMVISYPFWGGSRPPYCGH
PGFELTCDGEAPEFTMKEASYRILDINNSFHTLTVARADYWDSYCPPTYVNTTLNESIFS
YNATYTDVTLYYDCPQLTIAPSNQFNCTNITGYYTTLDLNLSVSPGSCGVYVTVPIFQSA
ATAIVSGGGTLTLLTEALKGGFGLEWNASNSLCTECVESGGQCGYTSNQFTCYCRNGYPL
SSCQTTRSGSNVLRKIIIGIVAGVATLILVLAMLGCLRIIKCPLACKTLVFWKKESEDDE
NVEAFIRNYGSLAPKRYNYSDVKKMTNSFTSKLGEGGFGCVYKGKLPDGRMMAVKLLSKS
KGNGQDFINEVASISRTSHVNIVTFMGFCFERSRRALIYEFMPNGSLDKFIYNRGSSNES
LNLEWKTMYQIAVGIARGLEYLYRGCNTRILHFDIKPHNILLDQNFIPKISDFGLAKLCQ
KTESMVSMTHARGTTGYIAPEVFCRNFGGVSHKSDVYSYGMLVLEMVGGRKNIDVQVFQL
GFISSFSQARILQYFVVSPMKRRKKQRGRWFYWFHHRRNSITCE
Download sequence
Identical sequences GSVIVT01030995001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]