SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01031852001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01031852001
Domain Number 1 Region: 243-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-26
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-22
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01031852001
Sequence length 355
Sequence
MPEQETLDHSHCRRPSSQPTRSLLFYKLIVSSVLQAKRLRIPQKFVKKSGDQLSAVTTLT
LPNGGVWYVGLTKADNKFWFYHGWHEFVEYYSIHVGYFLIFRYEGNSNFNVNIFDLTASE
INYPSNNLRNSEKTSHGKQCPASDGEEMNDDDDSVEILGSASPVSLRSKVFDECIDQQPL
GKNYNENLHLAKDANSLQVTIRSSRDIGIQFNSSELTNSECKRWRVVTMEEKKRALHAAE
MFQPSNPFCRVILRRSYVHERFLLHMPSRFAEKYLNGVSKFIKLQTSDGKQWHVRCLSGE
SRVKLSKGWTEFVKDNNLEEGDVCVFELINMEDVVLKVSIFRVLDDARVETQSSN
Download sequence
Identical sequences D7TPT0
GSVIVT01031852001 29760.GSVIVG00036489001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]