SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01032251001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01032251001
Domain Number 1 Region: 121-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-44
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 935-1000
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000814
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01032251001
Sequence length 1034
Sequence
MKAPTNGAAAAATAAPNPCEGEKKSINPELWQACAGPLVNLPPAGTLVVYFPQGHSEQVA
ASMKKDVDAQIPNYPNLPSRLLCILHNVTLHADPETDEVYAQMTLQPVPAYDKESLLRSD
LALKTNKPQTDFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELVAKDLHD
NVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDAVLFIRDEKQQLLLGIRRANRQPTN
LSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKAAYSNQISL
GMRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGERRNRVSIW
EIEPVTAPFFICPPPFFRSKRPRQPGMPDDESSDLENLFKRTMPWLGDDICMKDPQAVHG
LSLVQWMNMQQNPPLGNSAQPNYMHSLSGSLDQLTKLPATLNPLGSVIQPQQQLNDIAQQ
PRQNLMNQTLPSSQVQAQLLQQPQALVQNHNILQQQPSPPDQANQQLQMSDNQIQLQLLQ
KLQQQQQSLLAQQSTMQQTAQLTQLQDPQRQLLDVSQNFSRSVASGQILEMPQATSTSLP
QSLVIPQQITKSNSQTNVRFSHPPQQPKLQQQQPGMLPELPGHVVLPPMTATNQLSTAGS
SLLTGAAGAGQSGITDDVPSCSTSPSTNNCPNVIQPILNGRAHRTTAMEEMAQSSATLLS
GSGLETISANANLVKDFQQKPDIKPSLNISKSHNQGFFAPQTYVNVAAVQTDYLDTSSSA
TSVCLSQNDHLQQNNNPLSFNQPSMMFRDTSQDREAQADPRNNVQFGTNIDSQLGIPMLP
DPILSKGMVGSGKEFSNNLSSGGLLANYENPKDAQQDLSSSIVSQSFGVPDMAFNSIDSA
INDSSFLNRGPWAPAPQFQRMRTYTKVYKRGAVGRSIDITRYSGYDELKQDLARRFGIEG
QLEDRQRIGWKLVYVDHENDVLLVGDDPWEEFVNCVRCIKILSPQEVQQMSLDGDIGNSV
LQNQACSSSDGGNA
Download sequence
Identical sequences GSVIVT01032251001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]