SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01032765001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01032765001
Domain Number 1 Region: 130-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.3e-54
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily PapD-like 2.59e-19
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01032765001
Sequence length 399
Sequence
MENRRLVEVSDHEVRIDFALGCKCRANVRLTSLSANTPIAFKVQTSSPQKFLVSPPTGLI
PPLSSAAFQVILKPQSQPPAMFPRSPTDRFLIKTALAAEFSTQSTQPDSINSWFASRPTQ
DLKLKVVFVGPFLLRHAVAAGDLLVEAGLKSEARAKIDKMSLEEETRWASKGWTGIHVAA
AFDRTEELARLVKLLGSGPLDFRDNEGRTALHLAVSKGNIQCARTLVEAGADPTITAGHR
GRSPLDIARDKGHKEIVEILEQGETVLTTARRGELKPLELLLQRGASINHRDQYGLTALH
VAAIKGHKDVALLLIRFGLGLECQDSEGHAPLHLAVEGGSMETVEVLVDEGANINARSKR
GATPLYMANALGYHDIAQFLVNRGASSSSLPPSSSPYHL
Download sequence
Identical sequences GSVIVT01032765001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]