SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01033108001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01033108001
Domain Number 1 Region: 71-398,439-585
Classification Level Classification E-value
Superfamily Clc chloride channel 5.23e-101
Family Clc chloride channel 0.0000623
Further Details:      
 
Domain Number 2 Region: 587-769
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-21
Family CBS-domain pair 0.0045
Further Details:      
 
Weak hits

Sequence:  GSVIVT01033108001
Domain Number - Region: 391-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00152
Family Growth factor receptor domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01033108001
Sequence length 789
Sequence
MEEDPSQVAETTTTTTSSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSH
IESLDYEINENDLFKHDWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIAG
YKLLAVSGLVEKKRYLTGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKAYLNGVD
TPNMFGASTLIVKIFGSIGAVSAGLDLGKEGPLVHIGSCIASLLGQGGPENYRIKWRWLR
YFNNDRDRRDLITCGASSGVCAAFRAPVGGVLFSLEEVATWWRSALLWRTFFSTAVVAVV
LRAFIEYCNSGKCGLFGRGGLIMFDVSDVTVTYHAMDIAPVALIGLIGGVLGSLYNHLLH
KVLRVYNLINQKGKIHKLLLSLSVSLFTSICLYCLPFLATCSPCDSSITETCPTNGRTGN
FKQFNCPDGYYNDLASLLFTTNDDAVRNIFSTNTATEFHPLSLLIFFGLYYILGLITFGI
AVPSGLFLPIILMGSAYGRLLGIAMGSYTKIDQGLYAVLGAASLMAGSMRMTVSLCVIFL
ELTNNLLLLPITMIVLLIAKSVGDCINPSIYDIILHLKGLPFLDANPEPWMRNLTVGELA
DAKPPVVTLRGVEKVARIVDVLRNTTHNGFPVVDEGVVPRVGLAIGATELHGIVLRAHLV
KVLKKKWFLQERRRTEEWEVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTP
YTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLA
KSKEREKGN
Download sequence
Identical sequences D7SVR2
XP_010660593.1.54126 XP_010660594.1.54126 GSVIVT01033108001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]