SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01033786001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01033786001
Domain Number 1 Region: 103-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000144
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 
Weak hits

Sequence:  GSVIVT01033786001
Domain Number - Region: 358-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00149
Family Anti-platelet protein 0.051
Further Details:      
 
Domain Number - Region: 220-276
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00528
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01033786001
Sequence length 485
Sequence
MERPEATPSLLLLAISFLCTIKWPQIQTAAATSQELLKGFTATPEPSTSSFQPLLTDPTG
NYSMGFLRVNRTQLALSVLHVPSAEPLWQADMARLARWSESTHFFFNGSLVISDPRTKVF
WSTGTNGDRILLLNTSNLQIQKLDKSPTVLWQSFHFPTNTLVENQNFTVNMSLVSSNGLY
SMRLGEDFIGLYENFKENPDQIYWKHGALEAKAEIVKGQGPIYIRLDSGGFLGMYQIGST
PVDVEAFYSFQHPIAGFRLLRLEPDGNLKGYYWTGSNWVLDYQAIKDQCELPGSCGSYGL
CRPGSGCSCIDNSTEYNSEKECLPPETGNLCSDIEGENKFRVLRRKGIELPYKELMGYET
TSSLEQCERSCENNCSCWGSVYNNASGFCYRVDYPIRTLLGVGDDTKVGYFKVREGPQKK
AESGFGFVIGLLGATVLAFGGVVGFGVYKVWRRKGAKGVSEEAGGVNPGPYKTLGAASFR
SIEMT
Download sequence
Identical sequences D7TJ25
GSVIVT01033786001 XP_002283448.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]