SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034026001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01034026001
Domain Number - Region: 206-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0107
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034026001
Sequence length 426
Sequence
MEVPFLSEAKSEIADKESKRLSSYQYVGRTGSVIPTASLAGTEVSVEEIRSAAAFSDYYP
PSLHAALISSPEPDPDEQAIVCQGAYGGDYGGNTNEFQRQILDEVEIRELLIDHVGHRCC
WGSRPARTWKIHAVEDCNVYVGTLETFIEEREIIKEREPYHGGKIDGKDKGPGLGIWELD
LRSEFPVLFVPHKESCAKIPHSEAIEKCSGCAGRGDIVCSTCNPGQEPGFYNENRMSQCP
TCHGRGLIAHRDGSDTKCVKCNGKGNISCPICGSRGLIKCELCRGGGSLLTHDVAVIRWK
TLSTRKVSATSGAASVPDEVFHRAKGVQLCNTQAHQCTPAFFADSFSLNKFSSEVIADRS
PVPPTARVVCERHSISVVPVTRVTMAHRRQSFSFYIIGFSREVYLKDYYPSRFCWGLCPC
LDWLKL
Download sequence
Identical sequences GSVIVT01034026001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]