SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034078001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01034078001
Domain Number 1 Region: 140-284
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-29
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Domain Number 2 Region: 521-572
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000178
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 
Weak hits

Sequence:  GSVIVT01034078001
Domain Number - Region: 416-459
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000255
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034078001
Sequence length 712
Sequence
MVFVFLLFAESNLVLEFSTLGLLIGTSLSGVWSDETRIIPNGSFVESTVNGEVMVPNQKA
NKYISLNQTSKMGNLSHASPKFPCILLTLLISYLFSFATCKTHNFLQRGSSLSVEDDSDY
ITSPDRSFTCGFYGAGENAYWFSIWFTNSKERTVVWMANRDRPVNGRGSRISLRRDGIMN
LRDADGSTVWETNTTSTDVDRAELLDTGNLVLKNPHGKILWQSFDFPTDTLLPNQILTRR
TKLISIIRGGDFSSGYYILYFDNDNILRMMYDGPSISSLYWPNPDLGILPNKRRNSNSSR
IAVLDEMGRFLSSDNASFRASDMGLGVKRRLTIGYDGNLRLYSLNHSTGLWMISWMAFGE
RNRVHGLCGRNGICVYTPEPKCSCPPGYEVSDPSDWSKGCKSKFHRSCSRPQQVKFVELP
HTDFYGSDVNHLTSVSLETCRKTCLEDCLCEAFAYRLTGNGLCFNKIALFNGFRSPNFPG
TIYLKLPVDVETSASTLVNVTSPVEDGYGFGAVYKGILEDERVGRHRLLVYEHVENLSLD
KHLFSTTFLGWKERFNVAVGTARGLAYLHHECLEWKIQCEEDNWIDDTVDRRLKGRFSRH
QAATLIEIVTGFVSRYQISKLHSRHWFFLFSSSFLGISKTFQRWMSTAVDFSFEWKGCIW
FQIGYSPGSEHNHLEQLVRQKMEEVELAVAKGRFAVCRRRNTLKLPMAFILS
Download sequence
Identical sequences GSVIVT01034078001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]