SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034087001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01034087001
Domain Number 1 Region: 175-328
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.93e-16
Family Protein kinases, catalytic subunit 0.0088
Further Details:      
 
Weak hits

Sequence:  GSVIVT01034087001
Domain Number - Region: 64-90
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0187
Family alpha-D-mannose-specific plant lectins 0.048
Further Details:      
 
Domain Number - Region: 110-143
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.031
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034087001
Sequence length 345
Sequence
MGNLFSSFLLILLISFFFSFTTSKTQNFLQRGSSLSVEDDSDDYITSPDKSFTCGFYGMG
ENAYWFSIWFTNSKERTVVWMANRNRPFNQSCSQTQQVKFLELPQTDYYGFDLNYSQSVS
MEACRKICLDDCLCQGFAYRLTGEGNCYAKSTLFNGYKSSNFPGSLYLKLPVDIETPFRR
FSYTELKKATNNFKVELGRGGFGAGRHRLVVYEHVENLSLDKHLFSTSYNGFEPKIADFG
LAKLSQRGGPGSGEFSRIRGTKGYMAPEFVRAVKRKIQYGEDNWVEDTVDPRLKGKFSRQ
QATMLVEIGISCVEEDRSKRPTMATVVQVLLECEGEAQVQTLDLE
Download sequence
Identical sequences GSVIVT01034087001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]