SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034405001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01034405001
Domain Number 1 Region: 60-102
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000314
Family alpha-D-mannose-specific plant lectins 0.019
Further Details:      
 
Domain Number 2 Region: 343-383
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000262
Family alpha-D-mannose-specific plant lectins 0.025
Further Details:      
 
Weak hits

Sequence:  GSVIVT01034405001
Domain Number - Region: 161-206
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00294
Family Hairpin loop containing domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034405001
Sequence length 398
Sequence
MAISLLAGCLNAAYELWLAGNFQPVDTISQGQSITTSQTIISAGGEFELGFFSPGNSTKY
YVGIWYKKVSEPTIVWVANRDYSFTDPSVVLTVRTDGNLEVYAYCGPFGICHDHAVDRFC
ECLPGLEPGFPNNWNLNDTSGGCVRKADLQCGNSTHDNGERDQFHRVSNVRLPDYPLTLP
TSGAMQCESDCLNNCSCSAYSYYMEKLVTFISFCSFKQQVEGMANCYTGHFRNFSLCHLG
DTEKATKKSTIMVQNLKNNMLKFQHIVLRCFCEFIAHVLKWTRDLCEFFFQNSSIIIQTC
VTSKFQPEDTILQGQSLTTSHTIIFVAGNFELGFFSPRKSTKYYVGIWYKKISKQTIVWV
ANRDYSFTNPSVVVTVNTDLSLSTYRLFYILFIYFYFN
Download sequence
Identical sequences GSVIVT01034405001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]