SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034406001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01034406001
Domain Number 1 Region: 305-612
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-84
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 152-209
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000824
Family Pan module (APPLE domain) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034406001
Sequence length 637
Sequence
MRIGDLKMTSNGTWDRDGQAFSLISEMRLNEVFNFSYSFSKEESYINYSIYNSSKICRFV
LDVSGQIKQMSWLEASHQWHMFWFQPKTQCEVYAYCGPFGICHDHAVDRFCECLPGFEPG
FPNNWNLNDTSGGCVRKADLQCGNSTHDNGERDQFYRVSNVRLPDYPLTLPTSGAMQCES
DCLNNCSCSAYSYYMEKCTVWGGDLLNLQQLSDDNSNGQDFYLKLAASELSGKGNKISSS
KWKVWLIVTLAISVTSAFVIWGIRRRLRRKGENLLLFDLSNSSVDTNYELSETSKLWSGE
KKEVDLPMFSFASVSAATNNFSIENKLGEGGFGPVYKGKSQKGYEVAVKRLSKRSGQGWE
ELKNEVMLIAKLQHKNLVKLFGYCIEKDEKILIYEYMPNKSLDFFLFDPTKHGILNWKTR
VHIIKGVAQGLLYLHQYSRLRIIHRDLKASNILLDKDMNPQISDFGMARIFGGNESKATN
HIVGTYGYMSPEYALEGLFSTKSDVFSFGVLLLEILSGKKNTGFYQTDSLNLLGYAWDLW
KDSRGQELMDPGLEETLPTHILLRYINIGLLCVQESADDRPTMSDVVSMLGNESVRLPSP
KQPAFSNLRSGVEPHISQNKPKICSLNGVTLSVMEAR
Download sequence
Identical sequences GSVIVT01034406001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]