SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01034419001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01034419001
Domain Number 1 Region: 161-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01034419001
Sequence length 305
Sequence
MDAFFGHIPGGFGRDSVFHAGFMPIQAVFQNPFMPTAVRAPPLSYNLSAPLSIEVAKRPE
MNVFSASQCPKIGNPSDISSSDSIHTQKMLRLSMDVSSDRHEIVNLGASDKHELPLLWKN
NAPSVTLSDIINSSETRPGSSPPANIHEDDEEIKGKGWLMLVQKELRNTDVGNLGRIVLP
KKDAEANLPPLVAKDGLVLQMEDMKYSVNWKFKYRYWPNNRSRMYVMENTGNFVKMHDLQ
PGDLFVVYKDESSGKYIVRGKKAVKPAHAEDKDGSIHRHRVGEADRDWYRQIWPEQGTSI
QLGTL
Download sequence
Identical sequences D7TY21
GSVIVT01034419001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]