SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01035328001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01035328001
Domain Number - Region: 1170-1198
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 0.00432
Family CO dehydrogenase ISP C-domain like 0.009
Further Details:      
 
Domain Number - Region: 801-875
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00746
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 48-58,315-361
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0175
Family Formin homology 2 domain (FH2 domain) 0.11
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01035328001
Sequence length 1439
Sequence
MTLSPSLNHLLITILYTLSILIVNPSSILAGEDSFAVDDIFYQDYSPPAPPPPPPLPPSV
SCSEDLHGIGSLDTTCQLVSNLQLTDDVYIEGKGNFYIGSGVRLDCLASGCSITVNISGN
FSLGENASIVTGAFELSAYNSSLHNGSVVNTTALAGTAPPQTSGTPQGVDGAGGGHGGRG
ACCLVDKKKLPEDVWGGDAYSWSSLQKPVSFGSKGGTTTKEEDYGGHGGGRVKMEIAGFL
VVDGSILADGGHGGSKGGGGSGGSIYIKAYKMTGSGRISACGGNGFGGGGGGRISVDVFS
RHDDPKIFVHGGSSFGCPENSGAAGTFYDAVPRSLIVSNNNRSTDTDTLLLEFPYQPLWT
NVYVRDHAKATVPLLWSRVQVQGQISLYCGGVLSFGLAHYALSEFELLAEELLMSDSIIK
VYGALRMSVKMFLMWNSKLLIDGGGDANVATSLLEASNLVVLKESSVIHSNANLGVHGQG
LLNLSGPGDWIEAQRLVLSLFYSIHVGPGSVLRGPLENATTDAVTPRLYCELQDCPTELL
HPPEDCNVNSSLSFTLQICRVEDITVQGLIKGSVVHFHRARTIAVQSSGKISTSRMGCTG
GVGRGKFLSSGLGSGGGHGGKGGDGCYKGSCVEGGISYGNADLPCELGSGSGSGNDTLDG
STAGGGVIVMGSLEHPLSSLSIEGSVKADGESSRESTRNNYYSMNNGSNVNPGGGSGGTI
LLFLRSLALGEAAVLSSIGGHGSLHGGGGGGGGRIHFHWSDIPTGDVYQPIASVKGSIHS
RGGLARDQSGMGENGTVTGKACPRGLYGIFCEECPAGTYKNVTGSDRSLCRHCPYHELPR
RAIYISVRGGIAETPCPYKCISDRYHMPHCYTALEELIYTFGGPWLFCLLLLGVLILLAL
VLSVARMKFVGVDESPGPAPTQHGSQIDHSFPFLESLNEVLETNRAEESQSHVHRMYFMG
PNTFSEPWHLPHTPPEQIKEIVYEGAFNGFVDEINAIAAYQWWEGSMHSILSILAYPLAW
SWQQWRRRKKLQQLREFVRSGYDHACLRSCRSRALYEGLKVAATSDLMLAHVDFFLGGDE
KRTDLPFRLQQRFPMSLPFGGDGSYMAPFSLNSDNILTSLMSQAIPPTTWYRLVAGLNAQ
LRLVRRGRLRVTFRPVLRWLETHASPALRVHGVQVDLAWFQSTACGYCQYGLLVYAVEDE
TESTPVDGVDGAIQNEHQSRDFGAAMLLSGARRSTESLMKRKKPYGYILDTNSLHMLEEK
KDIFYPLSFIIHNTKPVGQHDLVGLVISMLLLADISLVLLTLLQLYSISLADVFLVLFVL
PLGILLPFPAGINALFSHGPRRSAGLARVYALWNITSLINVMVAFICGYVHYNTQSPSKK
LPNFQPWNINMDDSEWWIIPTGLVVCKFIQSRLINWHIANLEIQDRSLYSNDFELFWQS
Download sequence
Identical sequences XP_010648308.1.54126 GSVIVT01035328001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]