SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01036177001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01036177001
Domain Number - Region: 36-81
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0126
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01036177001
Sequence length 302
Sequence
MCCRLRIVQARLHCTAAPTASPPPPPPKRRRPKRVKCKNKYYTHCYGMELNCPSTCPDRC
EVDCVTCSPVCNCNKPGAVCQDPRFIGGDGITFYFHGKKDRDFCLVSDSNLHINAHFIGK
RNQNMKRDFTWVQSLGILFDTHQLFIGAKKTATWDDSVDRLALVFDGEPIFLPDEEGVKW
QPEMSPEDVSVTRTQNTNAVEIEVEGNFMIKASVVPITEKESRVHNYDITAEDCFAHLDL
SFKFYSLSGNVSGVLGQTYGSKYVSRVKMGVAMPILGGEKEFASSGLFTTDCAVARFMVC
KR
Download sequence
Identical sequences GSVIVT01036177001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]