SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01036447001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01036447001
Domain Number 1 Region: 151-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-19
Family B3 DNA binding domain 0.0000711
Further Details:      
 
Domain Number 2 Region: 61-102
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000634
Family GCC-box binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01036447001
Sequence length 249
Sequence
MPMYMAMFEAIQESLPVCPSTTESALVTKMSDYSWRVGGTSGISDSENGVGAVYLRKLTS
SKYKGVVPQPNGRWGAQIYEKHRRIWLGTFNEEGEAAKAYDGIQDDIETTFLNSHSKAEI
VDMLRKHTYNDELEQSAHNYGSKESGADVMDSSKGGLLNFEDNGGKIWRFRYSFWNSSQS
YVLTKGWRRFVKEKNLKAGDIVSFHRSTGSDKRLFIEWEQRDSSRKPSMKQVESGQMVRL
FGVNLFSKS
Download sequence
Identical sequences GSVIVT01036447001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]